| Home | About us | Contact us | Our Team | Help |
 |
| p53 Database | ||||||||||||||
|
|
||||||||||||||
p53 Structures |
||||||||||||||
|
|
||||||||||||||
|
Detail Information of p53 in Mus musculus:
| Gene Symbol | Tp53 |
| Gene Name | transformation related protein 53 |
| Aliases | RP23-56I20.1, bbl, bfy, bhy, p53 |
| Gene Id | 22059 |
| Gene Type | protein coding |
| Accession No | NP_035770 |
| Molecular Weight | |
| Expression | |
| Taxonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea; Muridae; Murinae; Mus |
| Organism | mus musculus |
| Location | 11 39.0 cM |
| Description | Tumor protein p53, a nuclear protein, plays an essential role in the regulation of cell cycle, specifically in the transition from G0 to G1. It is found in very low levels in normal cells, however, in a variety of transformed cell lines, it is expressed in high amounts, and believed to contribute to transformation and malignancy. p53 is a DNA-binding protein containing DNA-binding, oligomerization and transcription activation domains. It is postulated to bind as a tetramer to a p53-binding site and activate expression of downstream genes that inhibit growth and/or invasion, and thus function as a tumor suppressor. Mutants of p53 that frequently occur in a number of different human cancers fail to bind the consensus DNA binding site, and hence cause the loss of tumor suppressor activity. Alterations of the TP53 gene occur not only as somatic mutations in human malignancies, but also as germline mutations in some cancer-prone families with Li-Fraumeni syndrome |
| Homology | Mouse, Rat |
| Related Disease | Adrenocortical carcinoma, pediatric,Breast cancer, Choroid plexus papilloma, Colon tumors, concurrent multiple primary, Hepatoblastoma, Hepatocellular carcinoma, Histiocytoma, malignant fibrous, Li-Fraumeni syndrome, LI-Fraumeni syndrome 1, Multiple malignancy syndrome, Nasopharyngeal carcinoma, Osteosarcoma, Osteosarcoma, multifocal, Pancreatic cancer |
| Pathways | MAPK signaling pathway, Cell cycle, p53 signaling pathway, Apoptosis, Wnt signaling pathway, Amyotrophic lateral sclerosis (ALS), Huntington's disease, Colorectal cancer, Pancreatic cancer, Endometrial cancer, Glioma, Prostate cancer, Thyroid cancer, Basal cell carcinoma, Melanoma, Bladder cancer, Chronic myeloid leukemia, Small cell lung cancer, Non-small cell lung cancer |
| Molecular Class | |
| Molecular Function | ATP binding, copper ion binding, DNA strand annealing activity, protein binding, transcription factor activity |
| Biological Process | caspase activation via cytochrome c, cell aging, central nervous system development, G1 DNA damage checkpoint, in utero embryonic development, negative regulation of apoptosis, negative regulation of cell growth |
| Cell Component | cytosol, mitochondrion, nucleolus, replication fork |
| Tissue Specificity | Lung fibroblast |
| Genome length | 1173 nt |
| AA Length | 390 aa |
| Genome Sequence | atgactgccatggaggagtcacagtcggatatcagcctcgagctccctctgagccaggag acattttcaggcttatggaaactacttcctccagaagatatcctgccatcacctcactgc atggacgatctgttgctgccccaggatgttgaggagttttttgaaggcccaagtgaagcc ctccgagtgtcaggagctcctgcagcacaggaccctgtcaccgagacccctgggccagtg gcccctgccccagccactccatggcccctgtcatcttttgtcccttctcaaaaaacttac cagggcaactatggcttccacctgggcttcctgcagtctgggacagccaagtctgttatg tgcacgtactctcctcccctcaataagctattctgccagctggcgaagacgtgccctgtg cagttgtgggtcagcgccacacctccagctgggagccgtgtccgcgccatggccatctac aagaagtcacagcacatgacggaggtcgtgagacgctgcccccaccatgagcgctgctcc gatggtgatggcctggctcctccccagcatcttatccgggtggaaggaaatttgtatccc gagtatctggaagacaggcagacttttcgccacagcgtggtggtaccttatgagccaccc gaggccggctctgagtataccaccatccactacaagtacatgtgtaatagctcctgcatg gggggcatgaaccgccgacctatccttaccatcatcacactggaagactccagtgggaac cttctgggacgggacagctttgaggttcgtgtttgtgcctgccctgggagagaccgccgt acagaagaagaaaatttccgcaaaaaggaagtcctttgccctgaactgcccccagggagc gcaaagagagcgctgcccacctgcacaagcgcctctcccccgcaaaagaaaaaaccactt gatggagagtatttcaccctcaagatccgcgggcgtaaacgcttcgagatgttccgggag ctgaatgaggccttagagttaaaggatgcccatgctacagaggagtctggagacagcagg gctcactccagctacctgaagaccaagaagggccagtctacttcccgccataaaaaaaca atggtcaagaaagtggggcctgactcagactga |
| AA Sequence | MTAMEESQSDISLELPLSQETFSGLWKLLPPEDILPSPHCMDDLLLPQDVEEFFEGPSEA LRVSGAPAAQDPVTETPGPVAPAPATPWPLSSFVPSQKTYQGNYGFHLGFLQSGTAKSVM CTYSPPLNKLFCQLAKTCPVQLWVSATPPAGSRVRAMAIYKKSQHMTEVVRRCPHHERCS DGDGLAPPQHLIRVEGNLYPEYLEDRQTFRHSVVVPYEPPEAGSEYTTIHYKYMCNSSCM GGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENFRKKEVLCPELPPGS AKRALPTCTSASPPQKKKPLDGEYFTLKIRGRKRFEMFRELNEALELKDAHATEESGDSR AHSSYLKTKKGQSTSRHKKTMVKKVGPDSD |
| Domains | MCNSSCMGGMNRR |
| Motifs | QSDISLELPLSQETFSGLWKLLPPE, SFVPSQKTYQGNYGFHLGFLQSGTAKSVMCTYSPPLNKLFCQLAKTCPVQLWVSATPPAG SRVRAMAIYKKSQHMTEVVRRCPHHERCSDGDGLAPPQHLIRVEGNLYPEYLEDRQTFRHS VVVPYEPPEAGSEYTTIHYKYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACP GRDRRTEEENF, QKKKPLDGEYFTLKIRGRKRFEMFRELNEALELKDAHATEES |